SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009773 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009773
Domain Number 1 Region: 114-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.7e-43
Family UAS domain 0.000000209
Further Details:      
 
Domain Number 2 Region: 359-469
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-27
Family UBX domain 0.00000192
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009773
Domain Number - Region: 3-35
Classification Level Classification E-value
Superfamily UBA-like 0.00485
Family TAP-C domain-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009773   Gene: ENSMLUG00000010710   Transcript: ENSMLUT00000010722
Sequence length 470
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429872:347710:388434:1 gene:ENSMLUG00000010710 transcript:ENSMLUT00000010722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAISGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPSTSSASVSTVRPHTEEEVRA
PIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAIDKKLTTLA
DLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNDAVKNIIRE
HFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEWHQLDVSSFLDQVTGFLG
EHGQLDGLSSSPPKKCARSESLIDASEDSQLEAAIRASLQETHFDSSQTKQDSRSDEESE
SELFSGSEEFISVCGSDEEEEIENLAKSRKSPHKDLGHRKEENRRLLTEPPPRTEPVTTT
NHQGLSVMDSEILEMSPEKSDGIVEGIDVNGPKAQLMLRYPDGKREQITLPEQAKLLALV
KHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQETVFVQERN
Download sequence
Identical sequences G1PGK6
ENSMLUP00000009773 ENSMLUP00000009773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]