SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009801 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009801
Domain Number 1 Region: 375-486
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-26
Family PDZ domain 0.0068
Further Details:      
 
Domain Number 2 Region: 13-107
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-24
Family PDZ domain 0.00049
Further Details:      
 
Domain Number 3 Region: 200-288
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-18
Family PDZ domain 0.039
Further Details:      
 
Domain Number 4 Region: 669-779
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000248
Family Nucleotide and nucleoside kinases 0.002
Further Details:      
 
Domain Number 5 Region: 487-567
Classification Level Classification E-value
Superfamily SH3-domain 0.000000269
Family SH3-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009801   Gene: ENSMLUG00000010732   Transcript: ENSMLUT00000010751
Sequence length 926
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430504:169310:187152:1 gene:ENSMLUG00000010732 transcript:ENSMLUT00000010751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFPLCQVLDMEELTIWEQHTVTVCKDPRRGFGIAISGGHDRPGGPVFVSDVVPGGPAEGR
LQTGDQIVMVNGVSMENVNSTFAIHILKTCTKLANITVKRPRKIQLPSTKASPCGPGHQD
SDEDGPWRLEDANHGRGYEGDTSSGSGRSLGERSHRPRAGRRSRAGNHGSRSPGGGSEVR
GLALMSGFKRLPRQDVQMRPLKSVLVRRRESEEFGVKLGSQIFIKHITDSGLAAQNGGLQ
EGDLVLQINGVSSENLSLSDTRQLIEKSEGKLTLLVLRDREQFLVNIPPAVSDSDSSLLE
DISDLCSELSQAPPSHVPPPPQHRQRSPDTDRTNSPVESPQLRRRSSVDSRTTLEPGTRR
VDTPRQSSYDIYRVPSRQSMEDRGYSPDSRVVRFYKGTSIGMKLAGGNDVGIFVSGVQEG
SPAEEQGIQEGDQILQQVNDVPFRNLTREEAVQVLLGLPLGEEVELVTQRKQDIFRKMVQ
SRVGDSFYIRTHFELEPSPPYGLGFTRGDVFHVLDTLYPGPGQGHARGGQWLAVRMGRDL
REQERGIIPNQKRAEQLASLEAAQRALGPGPGASAGSGGRAEFWRLRGFRRGAKKTSHRS
REDLSDLTRQGHYPPYERVVLREANFKRPVVILGPVADIAMQKLTAEMPDQFEIAESVLR
TDRPSKIIKLDTVRVIAEQDKHALLDVTPSAVERLNYVQYYPIVVFCAPESRSALKALRQ
WLAPASRRSTRRLYAQAQKLWKHSDHLFTATVHLQGTSDGWYQELKAIIREQQMRPIWTA
EDQLDGSLEDNLDLPHRGLNDSSADLSCDSRVNSDYETDGEGYTDGEGYTDGEGGPHTDV
DEGPPAPALVRSSEPVLVEKPESLRDHGRSSGHQGAQVDSCHPQGQWRQESIRTYAREAV
RKKFTQARHVESSDEDGYDWGPATDI
Download sequence
Identical sequences G1PGM9
ENSMLUP00000009801 ENSMLUP00000009801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]