SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009827 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009827
Domain Number 1 Region: 213-358
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-47
Family Phosphotyrosine-binding domain (PTB) 0.00000243
Further Details:      
 
Domain Number 2 Region: 374-493
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-19
Family PDZ domain 0.00035
Further Details:      
 
Domain Number 3 Region: 487-570
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-16
Family PDZ domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009827   Gene: ENSMLUG00000010776   Transcript: ENSMLUT00000010780
Sequence length 578
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430504:187520:193685:-1 gene:ENSMLUG00000010776 transcript:ENSMLUT00000010780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEFLTTPPSPPGPLAMDLEEPRDTHAPSQDHSPDCQWDPVPGGPCSLSQMELDGPNIQDL
AQQLEALPGDLVGLSPDGLPCPLHIATGHGLASQDVADAHGLLSAEAGRDDLLSLLHLEE
CPPSQSCPKEPPDPAPHLLQPPEDPDGDTGSPEWAEGACAEQHGRRSSSSSPEPWLETVP
LIAPEERPASAQSPKTAASYPAFQEVSGPCDHEDLCDGVIFGAKYLGSTQLVSERNPPPS
TRMAQAQEAMDRVKAPDGETQPMTEVDLFISTKRIKVLMADSQEAMMDHALQTISYIADI
GSVLVIMARRRLARRPASQAHGHRLYKMICHVFHSDDAQLIAQAIGQAFAVAYSQFLRES
GIDPSQVGTQPSQGATGSGYLHNGDLDHFSNSENCKEVVIEKRQGEGLGVALVESGWGSL
LPTAVIANLLHGGPAERSGSLSIGDRLTAINGTSLVGLPLASVQAAIREVKSQTLVTLSI
VHCPPVTTAIIHRPHAREQLGFCVEDGIICSLLRGGIAERGGVRVGHRIIEINGHSVVAT
PHARVIELLTEAHTEVHIKTMPATTYRLLTGQEQPVYL
Download sequence
Identical sequences G1PGQ2
ENSMLUP00000009827 ENSMLUP00000009827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]