SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009828 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009828
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000221
Further Details:      
 
Domain Number 2 Region: 373-409
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000484
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009828
Domain Number - Region: 181-271
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000136
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009828   Gene: ENSMLUG00000010787   Transcript: ENSMLUT00000010781
Sequence length 413
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430231:419814:461637:-1 gene:ENSMLUG00000010787 transcript:ENSMLUT00000010781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSEQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASSTFRVVGVKLQDQQVV
INYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQEGGPS
TQRQVQNGPSPDEMDIQRRQVMEQQRQESLERRTSATGPTLPPGHPSSAVSAPLSCSGPP
PPPPPPVPPPPTGATPPPPPPLPAGGAQGASHDESSVSGLAAALAGAKLRRVQRPEDASG
GSSPSGTSKSDANRASSGGGGGGLMEEMNKLLAKRRKAASQTDKPADKKEDESQTEEPST
SPSPGTRAASQPPNSSEAGRKPWERSNSVEKPVSSLLSRTPSVAKSPEAKSPLQSQPHSR
MKPAGSVNDVALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTS
Download sequence
Identical sequences G1PGQ3
ENSMLUP00000009828 ENSMLUP00000009828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]