SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009833 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009833
Domain Number 1 Region: 417-699
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-78
Family Protein kinases, catalytic subunit 0.0000000462
Further Details:      
 
Domain Number 2 Region: 864-1006
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 6.15e-57
Family FAT domain of focal adhesion kinase 0.00000608
Further Details:      
 
Domain Number 3 Region: 138-256
Classification Level Classification E-value
Superfamily Second domain of FERM 6.93e-42
Family Second domain of FERM 0.0000184
Further Details:      
 
Domain Number 4 Region: 37-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 2e-33
Family First domain of FERM 0.00036
Further Details:      
 
Domain Number 5 Region: 261-366
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-30
Family Third domain of FERM 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009833   Gene: ENSMLUG00000010735   Transcript: ENSMLUT00000010787
Sequence length 1009
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:39239149:39288209:-1 gene:ENSMLUG00000010735 transcript:ENSMLUT00000010787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVSQPLSRVKVGTLCRPEGPPEPMVVMPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREVIASILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEY
LHVEAEWRYDLQIRYLPEDFMESLKEDKTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQESLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFAHIDQETYRCELIQGWNITVDLVIGPKGIRQMTSQDAKPTCLA
EFKQIKSIRCLLLEEGEAVLQLDIEGAPQSLSIKTSSLAEAENMADLIDGYCRLQGEHKA
SLIIHPKKDGEKRTSLPQIPVLSLEAQRPRLSESCSIESDIYAEIPDETLRRTGGSQYGI
AREDVVLNRILGEGFFGEVYEGAYTNHKGEKINVAVKTCKKDCTQDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIVMELYPHGELGHYLERHKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASAECVKLGDFGLSRYIEEEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSERPRFNELVCSLSDVYQMEKDLAIEQERNARYRPPKILEPIVFQDPPPKPSRP
KYRPPPQTNLLAPNLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAERAKMRQILDKQQKQMVEDYQWLRREEKSLDPMVHMNDKSP
LTPEKEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDMVYDNVMDLVQAVLDLKNKLCQ
LPPEAYVMVVKNVGLTLRKLIGSVDSILPSLPASSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKILANLAHPPAE
Download sequence
Identical sequences G1PGQ8
XP_006082010.1.53796 XP_006082011.1.53796 ENSMLUP00000009833 ENSMLUP00000009833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]