SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009878 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009878
Domain Number 1 Region: 805-834
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000285
Family A20-like zinc finger 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009878
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily UBA-like 0.000459
Family TAP-C domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009878   Gene: ENSMLUG00000010828   Transcript: ENSMLUT00000010836
Sequence length 843
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429918:1162509:1182881:-1 gene:ENSMLUG00000010828 transcript:ENSMLUT00000010836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVSAALSDFEQLRQVHAGILPQSFSEGS
GASRNPEKGFSDRECTRPPRPTLQRQDDIVQEKRLSRGISHASSSIVSLARSHVSNGGGG
GSSEHPLEMPICAFQLPDLTVYNEDFRSFIERDLIEQSMLVALEQAGRLNWWVSVDPTCQ
RLLPLATTGDGNCLLHAASLAGMWGFHDRDLMLRKALYALMEKGAEKEALKRRWRWQQTQ
QNKESGLVYTEDEWQKEWNELIKLASSEPRMHLGTNGANCSGVESSEEPVYESLEEFHVF
VLAHVLRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPASQCHRSPLVLAYDQAHFS
ALVSMEQKENGKEQAVIPLTDSEHKLLPLHFAVDPGKSWEWGKDDSDNVRLASVILSLEV
KLHLLHSYMNVKWIPVSSDAQAPLAQPESPTASAGDEPRSTPESGESDKESVGSSSTSNE
GSKRKEKSKRDREKDKKRADSVANKLGSFGKTLGSKLKKNMGGLMHSKGSKPGGMGTGSG
VSSGTETLEKKKKNSLKSWKGGKEEAAGDGPVSEKPTSESVGNGGSKYSQEVMQSLSIMR
TAMQGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKESERKIMNGGVGSG
PPPAKKPEPDGGEELLTAPQTESKAMAFSTGYPGGFTIPRPSGGGVHCQEPRRQLAGGPC
GGGLPPYATFPRQCPPGRPYPHQDSSLSLEPGSHSQDGVHRGTLLPPHFRVADSYSNGYQ
EPPEPDGWAGGPRGLPTTQTKCKQPNCSFYGHPETNNFCSCCYREELRRKEREPGGELLV
HRF
Download sequence
Identical sequences G1PGU8
ENSMLUP00000009878 ENSMLUP00000009878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]