SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009910 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009910
Domain Number 1 Region: 896-1030
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.2e-18
Family cAMP-binding domain 0.028
Further Details:      
 
Domain Number 2 Region: 646-760
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000251
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009910
Domain Number - Region: 740-799
Classification Level Classification E-value
Superfamily PAZ domain 0.0643
Family PAZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009910   Gene: ENSMLUG00000010824   Transcript: ENSMLUT00000010871
Sequence length 1157
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429904:2090995:2178827:-1 gene:ENSMLUG00000010824 transcript:ENSMLUT00000010871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRTNRMSMNLSTTNYTFHNKGFSGSWVEFVKNKFNTYPQDLPEIILILALICTIGAILNL
HLKDFIIPLPVILFLIGCSFEILSFASDQVCIVLRYAHAIQWMDSQLFYYLFTPVIIFNV
AFDMDVYMFQKLFWQIILITIPGCFINYTLILWYLTSMNKLRLKTTPWLLFASILMSSDP
MLTAAAVRDLGLSRGLINLINGESLVTSIMSYNMFASIMDFNTDQKSMNHSLARSIVSPI
LSYYLSSFLFGILSAKLVHLWMSTVFGDDINHISLNFSNMYLIFFICKIGELVGMSGVFT
LAIMGLFLNSTSLKPGVESLLLEKCRFWNCLAFVAFLMVFTFIGLLIPAHTYLYVSFSDI
YYSLNIYFTLIVLRLLVFLLLSPLLSRLGDGFSWRWAFIMVWSEMRGLPNVTMALLLAYS
DLSVGTEREKSQVLFHGVSVCLITLIVNRIILPMVVSKLGLRDVTSTKYKSLYYTFQHFQ
EITKSAASALKFDKDLANADWNMVEKAIIFQNPYALSQGETTEHQKVNCPNCKTEINETL
NIEAMELANRRILSAQIASYQRQYRNESLSQSAVQMLVGAAGSFGEKGEYMSLETIKNYS
ESKTILTFVRKVLLNWVYNTKKEKGIPSRRYCFLNVFHKIVFTDEFEYVGYLVILMNTFP
IIISWMPTIYYTYDDELRQANYVFMGFYILECLVKIAAMRKEYFLHAWNLFELVIALIGI
VDVIIVEAESIYNIFDLDEIVVFFKAIRLLRILRILKLITPKLLQFIDKRMSHQLSYKYA
ILKGYVQGEADIMTIIDQIASSKQVKQVLLKRITRNTVHALKELGYLEYDHPEIAVTMKT
KEEINVMLSLAREIVRVFRLRGILHKIEANEINKLIMDKKRELLDFEPIVKSLTLTEALY
HIPWLDKNSDHINFIQEKAKLITFDCGNTIFEEGDETLGIYVIISGMIKLQRSKSGLMAD
QLLSESEGKDNQIIFTDYVISGETIGELNCLTNEPMKYSAICKTVVETCFIPKSHLYDAF
EYLSPDIEYKMWLKLGLSITAQKIREHLSYEDWTYKMQLKLSNVYVKDIPKSTKCDIYDE
HVIYVILIHGAVEDCHLRKAYKAPSSIPLTCHQIQGTENFTKVMIVQTSIDTKKFRWKTK
KFVPLLKSSVPGEQECE
Download sequence
Identical sequences G1PGX8
ENSMLUP00000009910 ENSMLUP00000009910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]