SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009921 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009921
Domain Number 1 Region: 222-607
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.82e-158
Family Myotubularin-like phosphatases 0.00000000000936
Further Details:      
 
Domain Number 2 Region: 99-220
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-41
Family GRAM domain 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009921   Gene: ENSMLUG00000010872   Transcript: ENSMLUT00000010882
Sequence length 665
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429807:3207482:3270062:-1 gene:ENSMLUG00000010872 transcript:ENSMLUT00000010882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALHGRQAAAAAGSEGAGGPGPGPAGGWRPPRVAGAPPAGSRQPSVETLDSPTGSHVEWCK
QLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKDVMYICPF
MGAVSGTLTVTDFKMYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDM
RNLRLAYKQEEQSKLGIFENLNKHAFPLSNGQTLFAFNYKEKFPINGWKVYDPVAEYKRQ
GLPNESWKISKVNSNYDLCDTYPAIIVVPTNVKDDDLAKVAAFRAKGRVPVLSWIHPESQ
ATITRCSQPLVGPSDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKAKGGGYE
SESAYPNAELVFLEIHNIHVMRESLRKLKEIAYPSIDETRWLSNVDGTHWLEYIRMLLAG
AVRIADKIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDSYYRTIKGFEILIEKEWISFGH
RFALRVGHGNDNHADADRSPIFLQFIDCVWQMTRQFPSAFEFNELFLITILDHLYSCLFG
TFLCNCEQQRFKEDIYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASMSHLELWVN
YYVRWNPRMRPQMPIHQNLKELLAVRAELQKRVEDLQREVATRASSPSERGSSPSHSVTP
VHTSV
Download sequence
Identical sequences G1PGY8
ENSMLUP00000009921 ENSMLUP00000009921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]