SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009975 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009975
Domain Number 1 Region: 568-683
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-25
Family PDZ domain 0.0021
Further Details:      
 
Domain Number 2 Region: 437-550
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-24
Family PDZ domain 0.0053
Further Details:      
 
Domain Number 3 Region: 223-316
Classification Level Classification E-value
Superfamily PDZ domain-like 8.68e-22
Family PDZ domain 0.015
Further Details:      
 
Domain Number 4 Region: 328-425
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-21
Family PDZ domain 0.012
Further Details:      
 
Domain Number 5 Region: 41-95
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000104
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009975   Gene: ENSMLUG00000010946   Transcript: ENSMLUT00000010943
Sequence length 688
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429994:686971:719574:-1 gene:ENSMLUG00000010946 transcript:ENSMLUT00000010943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTSDEMVSVEHTSSSFNPLCFECGQQHWTRENHLYNYQNEVDDDLVCHICLQPLLQPL
DTPCGHTFCCKCLRNFLQEKDFCPLDRKRLHFKLCKKSSILVHKLLDKLLVACPFSSVCQ
DVMQRCDLEAHLKNRCPGASHQRVALERRKTSKTQTEIENENGTTIIDLPSTLSPETDCS
GTGTVPAERNLTSASLPVWTEEPGLDNPAFEESTIADTTQQPPSLPEGEITTIEIHRSNP
YIQLGISVVGGNETPLINIVIQEVYRDGIIARDGRLLAGDQILQVNNYDISNVSHNYARA
VLSQPCSTLQLTVLRERRFGNRVNSHSDGNSPREEIFNVVLYKRDYGEQLGIKLVRRTDE
PGVFILDLLEGGLAAQDGRLSSNDRVLAINGHDLKHGTPELAAQIIQASGERVNLTIARP
GKPQPGNTIREAGTQSSSQHHAQPLYYSRPSSHKDLTQCVTCQEKHITVKKEPHESLGMT
VAGGRGSKSGELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAVAMLKAS
AASPAVALKALEVQVVEEATQATDEQPSTFSENEYDASWSPSWIMWLGLPSSLHSCHDIV
LRRSYLGSWGFSIVGGYEENHTNQPFFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTVGM
SHSALVPMLKEQRNKVTLTVICWPGSLV
Download sequence
Identical sequences G1PH38 S7NDM2
XP_005877310.1.60319 XP_005877311.1.60319 XP_006098328.1.53796 XP_014319389.1.53796 XP_014404051.1.60319 ENSMLUP00000009975 ENSMLUP00000009975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]