SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010009 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010009
Domain Number 1 Region: 1041-1120
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-20
Family SH3-domain 0.00079
Further Details:      
 
Domain Number 2 Region: 1211-1290
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-19
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 1122-1210
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-17
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010009   Gene: ENSMLUG00000010954   Transcript: ENSMLUT00000010984
Sequence length 1292
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429833:3183107:3286741:1 gene:ENSMLUG00000010954 transcript:ENSMLUT00000010984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPECDVGASKAVVNGLAPGSNGQDKDMDPTKVCTGKGAVTLRASSSYRDTPSSSPVSPQ
ESPQYESKPVLESENPPADEWRLSSSADANGNAQPSSLAAKGYRSVHPNLPSDKPQDSSP
LLNEVSSSRVRTDSQTFAPVSKPSSAYPSTTIVNPTIVLLQHNRDPVSERRVGERDLATT
QEKPTSPGRSTDKKAKDDSRRVAKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHK
LNRDDDSDLYSPRYSFSEDTKSPLSVPRSKSEMSYIDGEKVVKRSATLPLPARSSSLKSS
PERNDWEPPDKKVDTRKYRAEPKSIYEYQPGRSSVLNNEKMSRDISPEEIDLKNEPWYKF
FSELEFGKPTNLETEPTLCHTELEADVGKTETLSKAARADLAQSSAVSPTPEMSSEPPGY
IYSSNFHAVKRESDGAPGDLGSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKVDH
KGGNAHMISSSSVHSRTVNTSNALGPVCKHKKPLSAAKACISEILPSKFKPRLSAPSALL
QEQKSVLLPSEKAQSCENLCVSVSLNGSKRGLPLQVGGSIENLLMRSRRDYDSKSSSTLS
LQEYGSSARRPCPLSRKAGMQFTMLYRDMHQINRAGLFLGSASSSSVRDLASHFERSSLA
LARGELGPSQEGSEHIPKHTVSSRITAFEQLIQRSRSMPSLDLSGRLSKSPTPVLSRSGL
TAARSAESLLESTKLRPREVDGMNPGGVYASPTCSRMVDSPLGFRGLAPSEPLSTCSDEL
DHCSNVSSDSREGSGGSVHGDFPKHRLNKCKGTCPASYTRFTTIRKHEQQASRQPDWRPD
CRGDRSALLRNIYLMSPLPFRLKKPLQHHPRQPAPGDFSGPLAGRKPDLPGQPQQDEPRA
GGKPSVPKRLSSRHTMARLGRTAEPPQERPAVPEDCPGAFDNGNPVPYSDHSLDRNNNPP
SELGPSHGDSESPRHFIPADYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRH
TGVIPTHHQFITNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVY
IYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQILEYGEAIAKFNFNGD
TQVEMSFRKGERITLLRQVDENWYEGRIPGTTRQGIFPITYVDVIKRPLVKNRVDYIDLP
YSSPSRSATASPQQPQAQQRRVTPDRSQASQDLFSYQALYSYIPQNDDELELRDGDIVDV
MEKCDDGWFVGTSRRTRQFGTFPGNYVKPLYL
Download sequence
Identical sequences G1PH67
ENSMLUP00000010009 ENSMLUP00000010009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]