SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010020 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010020
Domain Number 1 Region: 14-123
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-24
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 2 Region: 211-316
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 2.19e-20
Family Platelet-derived growth factor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010020   Gene: ENSMLUG00000011003   Transcript: ENSMLUT00000010995
Sequence length 324
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429884:176324:256325:1 gene:ENSMLUG00000011003 transcript:ENSMLUT00000010995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLYRRDETIQVTGNGHVQSPRFPNSYPRNLLLTWRLHSQEKTRIQLAFDNQFGLEEAEND
ICRYDFVEVEDVSETSTIIRGRWCGHKEVPPRITSRTNQIKITFKSDDYFVAKPGFKIYY
SVVEDFQPAEASETNWESVTSSISVIYFSVAMTSAVLRAYDLTTSQISSMVTVKWFMPQF
FSPNLVISQYSVFLSTLHRKNRPCFHQDQKKMDLDRLNDDAKRYSCTPRNYSVNLREELK
LTNVVFFPRCLLVQRCGGNCGCGTVNRKSCKCTSGKTVKKYHEVLKFDPGHLRRRGRSNS
MALVDIQLDHHERCDCICSSRPPR
Download sequence
Identical sequences G1PH77
ENSMLUP00000010020 ENSMLUP00000010020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]