SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010059 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010059
Domain Number 1 Region: 11-284
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.93e-55
Family FCH domain 0.0014
Further Details:      
 
Domain Number 2 Region: 451-555
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-30
Family SH2 domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010059   Gene: ENSMLUG00000011004   Transcript: ENSMLUT00000011038
Sequence length 557
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:16166516:16261631:-1 gene:ENSMLUG00000011004 transcript:ENSMLUT00000011038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTIQ
VNYVSNVSKSWLLMIQQTEQLSRIMKTHAEDLNSGPLHKLTMMIKDKQQVKKSYIAVHQQ
IEAEMIKPNQSVNKVSLPKLKSSYRQLIKEMNSAKEKYTEALAKGKETEKAKERYDKATM
KLHVLHNQYVLALKGAQLHQNQYYDTTLPLLLDSLQMMQEEMIKALKGIFDEYSQITSLV
TEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTSATKEQEVEFDTSLLEENENLQANEIM
WNNLTAESLQVKLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSKTYEKKSDIVLLISQ
KQTLEELKQSVQQLRCTEAKFTAQKELLEQKVQENDGKEPPPVINYEEDARSVTSMERKE
RVSKLESFRHSIAGLIRGPKSAFGSTAVKFESMPIIEKPLTEQDWYHGAIPRIEAQDLLK
QQGDFLVRESHGKPGEYVLSVFSDGQRRHFIIQYVDSLYRFEGTGFSNIPQLIEHHFTTK
QVITKKSGVVLLNPIVK
Download sequence
Identical sequences G1PHB5
ENSMLUP00000010059 ENSMLUP00000010059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]