SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010063 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010063
Domain Number 1 Region: 217-488
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-80
Family Protein kinases, catalytic subunit 0.0000000804
Further Details:      
 
Domain Number 2 Region: 112-255
Classification Level Classification E-value
Superfamily SH2 domain 9.42e-39
Family SH2 domain 0.0000419
Further Details:      
 
Domain Number 3 Region: 38-157
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-24
Family SH3-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010063   Gene: ENSMLUG00000011037   Transcript: ENSMLUT00000011043
Sequence length 505
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429778:3885845:3972241:-1 gene:ENSMLUG00000011037 transcript:ENSMLUT00000011043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNICRRLWGYLKPCLPCFFRETDKQVAPENTESPCPAEAPWPQGSYFVALFDYQARTEE
DLSFHAGDKLQVLDTSHEGWWFARLLERRGASSGQQLEGYIPSNYVAEDRSLQAEPWFFG
AIKRADAENQLLYSGNQTGAFLIRESESEKGGFALSVLVERVVKHYKIRRLDEGGFCLTR
IRTFTTLNEFVRHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEIDRKSVQLLKR
LGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLIQLYAVCTLE
DPIYIITELMRHGSLLEYLRNDGGSKINLTQQVDMATQVASGMAYLESQNYIHRDLAARN
VLVGEHNIYKVADFGLARVFKVDNEDIYEATHDMKLPVKWTAPEAIRNRFSIKSDVWSFG
ILLFEIITYGQTPYSGMTGAQVIQRLLHNYRLPQPSNCPLSLYMIMLECWDAEPRNRPTF
EELYLKLEDYFEISCNYNDGKAMLN
Download sequence
Identical sequences G1PHB8
ENSMLUP00000010063 ENSMLUP00000010063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]