SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010135 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010135
Domain Number 1 Region: 42-174
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.22e-47
Family Regulator of G-protein signaling, RGS 0.00000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010135   Gene: ENSMLUG00000011119   Transcript: ENSMLUT00000011118
Sequence length 180
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429821:6464664:6481957:-1 gene:ENSMLUG00000011119 transcript:ENSMLUT00000011118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFLAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
Download sequence
Identical sequences G1PHI2
ENSMLUP00000010135 XP_005880278.1.60319 XP_006089053.1.53796 XP_006754540.1.95426 XP_006754541.1.95426 XP_008144145.1.99482 XP_008144146.1.99482 XP_014311571.1.53796 XP_014383851.1.60319 XP_015425462.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]