SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010136 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010136
Domain Number 1 Region: 97-289
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.89e-57
Family Astacin 0.000084
Further Details:      
 
Domain Number 2 Region: 746-853
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-38
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 584-694
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 4 Region: 296-405
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-35
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 5 Region: 405-537
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 6 Region: 877-970
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-25
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 7 Region: 695-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000004
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 540-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000947
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010136   Gene: ENSMLUG00000011094   Transcript: ENSMLUT00000011119
Sequence length 980
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:22397430:22480807:-1 gene:ENSMLUG00000011094 transcript:ENSMLUT00000011119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVFWGDIALDDEDLNIFQIDRTIDLTQNPFGKLGHTTGGYGDHGMSKKRGALYQLIDRIR
RIGSGLEQNNTVKEKVPLKFSGQNEKNRVPRAATSRTDRIWPGVIPYVIGGNFTGSQRAM
FKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGI
VVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIM
HYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESN
GNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKS
ALLGRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAALYEAICGGEIRKNEGQIQSPN
YPDDYRPMKECVWKIMVSEGYYVGLTFQAFEQGHQGNPGITSTSRDECLLSVKKIERHDN
CAYDYLEVRDGTKENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKE
EDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGW
PKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCG
AEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYVC
QCRNGFVLHENKHDCKEGTAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRV
KLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCGNKIPEPLVATGNKMFVRFVSDA
SVQRRGFQATHSTECGGRLRADSKPRDLYSHAQFGDNNYPAQVDCEWLLVSERGSRLELS
FPIFEVEEEADCGYDYIELFGGLDSTAMGLGRFCGSGPPEEIYSNGDAVLIHFHTDDTIN
KKGFHIRYKSIRYQDTTHIK
Download sequence
Identical sequences G1PHI3
ENSMLUP00000010136 ENSMLUP00000010136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]