SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010147 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010147
Domain Number 1 Region: 59-155
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-23
Family PDZ domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 546-648
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-23
Family PDZ domain 0.007
Further Details:      
 
Domain Number 3 Region: 330-436
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-18
Family PDZ domain 0.036
Further Details:      
 
Domain Number 4 Region: 818-928
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000266
Family Nucleotide and nucleoside kinases 0.0014
Further Details:      
 
Domain Number 5 Region: 649-721
Classification Level Classification E-value
Superfamily SH3-domain 0.000000249
Family SH3-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010147   Gene: ENSMLUG00000011106   Transcript: ENSMLUT00000011132
Sequence length 1230
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429798:4633:48146:1 gene:ENSMLUG00000011106 transcript:ENSMLUT00000011132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMAQVLQRLWLQAGRKLGLLKGHKIQDVSCLAKVFPKGTPWLSEGMNEILKAPGMEEVI
WEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMV
NGTPMEGVLHSFAVQQLRKSGKIAAIVVKRPRKVQLAPLQSGLPLNEEDRAFEVMDEFDG
RSARSGYSDRYSERSRLHSWENSLERGHPHDRPHSQERDRARDRSRGRSLERGLDRDDYD
RARDRSRGRSLERGLDQDYYDGARDRSRGRSLERGLDHDYGRGRDSSHGRGRSIDQDYDR
AYSPEVEYRHRGQPDARSKMSRSCEHLRLGSPTPEPRGRKDHEGDKPIGVLLTKSKANEE
YGLRLGSQIFIKEMTSTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQ
LVVLRDSKQTLIHIPALDDSDSEVLKPDISEIESNRSFSPEERRQPYSDYDYHSSNEKLK
EKPSLREDIQNRWSRMGSTPTPFKCAGDIAAATETSQEPKHQEEAPAPQPKALPRTFLRP
SPEDEAIYGPNTKMVKFRKGDSVGLRLAGGNDVGIFVGGIQEGTSADQEGLLEGDQILKV
NTQDFRGMVREDAVLYLLEIPKGEMVTILAQSRADVYREILACGRGDSFFIRSHFECEKE
TPQSLAFTRGEIFRVVDTLYDGKLGHWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRDN
AGDRADFWRMRGQRSGLKKNLRKSREDLTAAVSVSTKFPAYERVLLREAGFKRPVVLFGP
IADIAMEKLAHGLPDLFQIAKSEPKDAGSEKSSGVVRLNTVRQIIEQDKHALLDVTPKAV
DLLNYTQWFPIVIFFNPDSRQGVKTMRQRLDPTSNKSSRKLYDQANKLKKTCAHLFTATI
DLNAANDSWFGSLKDTIQHQQGEAVWVSEGKMEGLDDDAEDRMSYLTAMGADYLSCDSRL
ISDFEDTDGEGGAYTDNELDEPAEEPLVSSITRSSEPVQHEESVRKPSPEPRAQTRRATS
RDQLRDNSPPPAFKPEPPKARTQKREDSFDYSRSYEYMPNSPPAVAGNEIPGASAKGPPP
PIAAKPTFCKPILKPSTPVLPPESEEAGEGSEEQDNASKSVLGKVKIFEKMDHKARLQRM
QELQEAQNAREEIKEKNNPTVALVANKLRDGEGTPWSRPLVPQKGPSALYQDARGSYSSD
VEEEEYRQQLSEHSKRGYYGQPSRYRDTEL
Download sequence
Identical sequences G1PHJ2
ENSMLUP00000010147 ENSMLUP00000010147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]