SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010152 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010152
Domain Number 1 Region: 84-185
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-31
Family SH2 domain 0.000075
Further Details:      
 
Domain Number 2 Region: 29-80
Classification Level Classification E-value
Superfamily SH3-domain 0.000000701
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010152   Gene: ENSMLUG00000011145   Transcript: ENSMLUT00000011138
Sequence length 278
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429880:65959:84808:1 gene:ENSMLUG00000011145 transcript:ENSMLUT00000011138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSMRSAPAPPEPERPLPCSDGLDSDFLAVLTDYPSPDISPPIFRRGEKLRVISDEGGW
WKAISLSTGRENYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKIGSFMIRESETKKG
FYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQ
STAAPAVRSDSPVTLRQKTLDWRKMSRLQEDPEGAGNPLGVDESLFSYGLRESIASYLSL
AGDSGAPLDRKKKSISLLYSGSKRKSAFFSSSPPYFED
Download sequence
Identical sequences G1PHJ7
ENSMLUP00000010152 ENSMLUP00000010152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]