SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010157 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010157
Domain Number 1 Region: 312-436
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000021
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010157
Domain Number - Region: 38-90
Classification Level Classification E-value
Superfamily HR1 repeat 0.00238
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010157   Gene: ENSMLUG00000011147   Transcript: ENSMLUT00000011143
Sequence length 561
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429953:2330018:2345399:-1 gene:ENSMLUG00000011147 transcript:ENSMLUT00000011143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRNHRPLEDGSCSALEMEFKRGRFRLSLFSDPPEDTELQRKLDHEIRMREGACKLLAA
CSQREQTLEATKSLLVCNSRILSYMGELQRRKEAQVLGKTGRRPSGGGLLAERSPCRGRV
CISELRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGEDIQDTEMILVDRTLTDISFQNHLL
FTEAGPDFKLRLELYGACLEEEGALAGAPKRLATKLSSSLGRSSGRRVRASLESAGGSAS
SPVLLPTPAVSGPRYHLLAHTTLTLAAVQDGFRTHDLTLASHEEHPAWLPLYGSVCCRLV
AQPLCMTQPTASGSLRVQQAGERQDWARVHGVLKGTNLFCYRQPEDTDTGKEPLFTIAIN
KDTRVQAGELDQTTGRPFTLSISNQYGEDKVTHTLQTESRGDLQSWMEALWQLFFDMSQW
KQCCDEIMKIETPAPRKPPQALAKQRSLYHEMAIEPLDDIAAVTDILAQREGVRLETTPP
WLAMFADQPALPRPCSPASVAPARTHPLPWGRPRTFSLDAVPPDHPSEAPRLVAPLPPHR
SPRSRSLCRKGSPRTWLQSPV
Download sequence
Identical sequences G1PHK2
ENSMLUP00000010157 ENSMLUP00000010157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]