SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010159 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010159
Domain Number 1 Region: 416-810
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.57e-120
Family Oxysterol-binding protein 0.0012
Further Details:      
 
Domain Number 2 Region: 86-194
Classification Level Classification E-value
Superfamily PH domain-like 5.14e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010159   Gene: ENSMLUG00000011134   Transcript: ENSMLUT00000011145
Sequence length 810
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429864:234774:266471:1 gene:ENSMLUG00000011134 transcript:ENSMLUT00000011145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATELRGVVGPGPAAIAAPGGGSTGPPVVGSGGGRGDSAPGSGAAPGTVATASASGPGP
GAGAVAAAGPAPAPPAGGSGGSGGSVAGGSGSAREGWLFKWTNYIKGYQRRWFVLSNGLL
SYYRSKAEMRHTCRGTINLATASITVEDSCNFIISNGGTQTYHLKASSEVERQRWVTALE
LAKAKAVKVLQESDESGDEESVSQTDKTELQNTLRTLSSKVEDLSTCNDLIAKHGTALQR
SLSELESLRLPAESNEKIKQVNERATLFRITSNAMINACRDFLKLAQTHSKKWQKSLQYE
RDQRIRLEETLEQLAKQHNHLERAFRGAKVLPAHPSGSAGPGKDQCCSGKGDMSDEDDEN
EFFDAPEIITMPENLGHKRTGSNISGASSDISLDEQNKLQQEETKKEKRTKIPYKPNYSL
NLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVA
AFTVSSYSTTVSRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGW
TLHQEIKITSKFRGKYLSIMPLGTIHCIFKETGHHYTWKKVTTTVHNIIVGKLWIDQSGE
IDIINHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFILLGTWDEKMDCFKVQP
VAGENGGDARQRSCEAEESRVMLWKRNPLPKNAEYMYYFSELALTLNAWEPGTAPTDSRL
RPDQKLMEDGRWDEANAEKQRLEEKQRLSRKKREAEAVKATEDGTPYDPYKALWFKREMD
PITKELTHTYRGGYWECKEKQEWTACPDIF
Download sequence
Identical sequences G1PHK4
XP_006091887.1.53796 ENSMLUP00000010159 ENSMLUP00000010159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]