SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010185 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010185
Domain Number 1 Region: 518-881
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.4e-126
Family Oxysterol-binding protein 0.00098
Further Details:      
 
Domain Number 2 Region: 49-154
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-18
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010185   Gene: ENSMLUG00000011152   Transcript: ENSMLUT00000011174
Sequence length 883
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429819:5293972:5363425:1 gene:ENSMLUG00000011152 transcript:ENSMLUT00000011174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSDEKNLGVSPKLVSPSRSPSTCSSKQGSRQEQDSWEVVEGLRGEVNYTQEPPVQKGFL
LKKRKWPLKGWHKRFFYLDKGILKYAKSQTDIDREKLHGCIDVGLSVMSVKKSSKCIDLD
TEEHIYHLKVKSDDVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFPGPSVTDSAPGVSDS
LSSRKRSSISKQNSFQTGGSLSFSCGEIRVPLWLQSSEDMEQCSKDLAHCHSYLVEMSQL
LQSMDVLHRTYSAPAINAIQGGAFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFGGPQ
RLHSSNPNLSTLDFGEEKNNSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNTISTERE
KLKQLLEQDVASPSAQVIGLKRALSSALAQNTDLKGRLRRIHAESLLLEPPAADSLAEEN
STDDNRPLVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEGSEDDSYVSDISDNLSL
DNLSNDLDNERQTLGSVPESGGEAKCRRRTCLPAPCPNSSSVSLWNILRNNIGKDLSKVA
MPVELNEPLNTLQRLCEELEYSELLDKAARIPSALERMVYVAAFAVSAYASSYYRAGSKP
FNPVLGETYECIREDKGFRYFSEQVSHHPPISACHAESENFVFWQDVRWKNKFWGKSMEI
VPIGTTHVTLPAFGDHFEWNKVTSCIHNILSGQRWIEHYGEIVIKNLNDDSCHCKVNFIK
AKYWSTNSREIEGTVFDKSGKAVHRLFGKWHESIYYGGPSSSTCVWRANPMPKDYEQYYG
FTQFALELNEIDSSLKTLLPPTDTRFRPDQRFLEEGNVEEAEVQKQRVEQLQRDRRRVLE
ENNVEHQPRFFRKSADDSWVSNGTYLELRKDLGFSKLDHPVLW
Download sequence
Identical sequences G1PHM9
ENSMLUP00000010185 ENSMLUP00000010185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]