SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010190 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010190
Domain Number 1 Region: 792-948
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.61e-51
Family Nucleotide and nucleoside kinases 0.00000129
Further Details:      
 
Domain Number 2 Region: 506-605
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-33
Family PDZ domain 0.0000283
Further Details:      
 
Domain Number 3 Region: 352-447
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-27
Family PDZ domain 0.0000226
Further Details:      
 
Domain Number 4 Region: 248-352
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-27
Family PDZ domain 0.0000933
Further Details:      
 
Domain Number 5 Region: 608-722
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-26
Family SH3-domain 0.0000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010190   Gene: ENSMLUG00000011155   Transcript: ENSMLUT00000011179
Sequence length 952
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429771:13775938:13829597:-1 gene:ENSMLUG00000011155 transcript:ENSMLUT00000011179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHSDPSWGPVQERSSQHPASAQAPASSLPLGLGPGATTGDTEPPVLEGEPWVRGSVGAEA
PGRPPGPRPRSARAPPRVPPPSWSEQCECAPGTGSGGQRGNPALGWGGSGRGGAVPWHKH
QHCCKCPECKVTRLAALRREPPGYGDWQVPDPYGPGGGNGASTAYGGYSSQTPPSQAGAT
PTPRTKAKLIPTGRDVGPVTPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQASSAPLL
VNHKALEPSLSVNGSDGMFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPG
GAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPPETIMEVN
LLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQD
VRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLG
AVESKVSYPAPPQVPPARYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNIVGGEDGEG
IFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPE
EYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFS
YGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIE
SNREVPALGRGNQYWGKAPWDDDNSACLPAKHRCLHFMHYRGVVFLGPVKLPCIPVEPSS
EKPHLSGPVEPPSDTTRPRRENEVDGQDYHFVSREQMEKDIQDNKFIEAGQFNDNLYGTS
IQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANK
IYDKAMKLDQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL
Download sequence
Identical sequences G1PHN4
ENSMLUP00000010190 ENSMLUP00000010190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]