SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010195 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010195
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.22e-38
Family CAD domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010195   Gene: ENSMLUG00000011194   Transcript: ENSMLUT00000011186
Sequence length 217
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429825:6207994:6214861:1 gene:ENSMLUG00000011194 transcript:ENSMLUT00000011186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILIFFSISRPLTFMGSQTKKVLLTPLMQSPRPFRVSNHNRSSRRGVMASNLKDLLSKT
LDALLITSGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWTPSTNYITARQQPK
KSGIARVTFDLYKLSPKDFIGCLNVKATMYEMYSVSYDFRCTGLKALVRSMLRFLSHAAQ
VAGHFLIYVGKHMLQVLGDTEEQTSPGLRSRHKFTIG
Download sequence
Identical sequences G1PHN7
ENSMLUP00000010195 ENSMLUP00000010195 XP_014311813.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]