SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010212 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010212
Domain Number 1 Region: 22-156
Classification Level Classification E-value
Superfamily UBC-like 5.92e-49
Family UBC-related 0.000000493
Further Details:      
 
Domain Number 2 Region: 155-196
Classification Level Classification E-value
Superfamily UBA-like 1.34e-22
Family UBA domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010212   Gene: ENSMLUG00000011216   Transcript: ENSMLUT00000011206
Sequence length 198
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429815:4952324:4980705:-1 gene:ENSMLUG00000011216 transcript:ENSMLUT00000011206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NILISSIKNDSKRTSTNFKTSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKI
PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEP
DDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVA
LSSKSWDVETATELLLSN
Download sequence
Identical sequences G1PHQ4
ENSMLUP00000010212 ENSMLUP00000010212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]