SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010225 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010225
Domain Number 1 Region: 43-162
Classification Level Classification E-value
Superfamily PX domain 4.06e-32
Family PX domain 0.00061
Further Details:      
 
Domain Number 2 Region: 217-389
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000607
Family IMD domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010225   Gene: ENSMLUG00000011227   Transcript: ENSMLUT00000011222
Sequence length 392
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429810:422169:469511:-1 gene:ENSMLUG00000011227 transcript:ENSMLUT00000011222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQVVGEKDLILPNGGTPAGTSSPASSSSLLNRLQLDDDIDGETRDLFVTVDDPKKHVCTM
ETYITYRITTKSTRVEFDLPEYSVRRRYQDFDWLRNKLEESQPTHLIPPLPEKFVVKGVV
DRFSEEFVETRRKALDKFLKRITDHPVLSFNEHFNVFLTAKDLNAYKKQGMALLTRVGES
VKHVAGGYKLRSRPLEFAAIGEYLDTFALKLGTIDRIAQRIIKEEIEYLVELREYGPVYS
TWSALEGELAEPLEGVSACIGNCSTALEELTDDMTEDFLPVLREYILYSDSMKSVLKKRD
QVQAEYEAKLEAVALRKEDRPKVPADVEKCQDRMECFNADLKADMERWQNNKRQDFRQLL
MGMADKNIQYYEKCLMAWESIIPLLQEKQEAK
Download sequence
Identical sequences G1PHR7
ENSMLUP00000010225 ENSMLUP00000010225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]