SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010264 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010264
Domain Number 1 Region: 39-308
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.49e-59
Family Glycerophosphoryl diester phosphodiesterase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010264   Gene: ENSMLUG00000011272   Transcript: ENSMLUT00000011265
Sequence length 318
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430247:488885:494109:1 gene:ENSMLUG00000011272 transcript:ENSMLUT00000011265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVLYYALPALGSYAALSIFFLRRPRLLHTPGVPAFCPRLGAHRGGSGERLENTMEAME
NAMAQRSDLLELDCQLTRDGVVVVSHDENLSRQSGVNKDVGSLDFEELPLYKEELEVYFS
PGHFAHGSDRHMVRLEDVFQRFPRMPMSVEVKEENEKLIHKIASLVRHFDRNEITIWASE
KSSIMKKCKAANPEMPLSFTRCRVIRLLLLYYLGLLPFVPIPEKFLLCFLPTIINRTYFP
FSCSGLNKLTAVVTKWLIMRKSLIQHLEQRGVQVVFWCLNEESDFEVAYSLGATGVMTDY
PTALRRYLDNHRAAAPVS
Download sequence
Identical sequences G1PHV4
ENSMLUP00000010264 XP_006103377.1.53796 ENSMLUP00000010264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]