SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010283 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010283
Domain Number 1 Region: 529-775
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.29e-62
Family Nuclear receptor ligand-binding domain 0.000000000504
Further Details:      
 
Domain Number 2 Region: 417-499
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-27
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010283   Gene: ENSMLUG00000011289   Transcript: ENSMLUT00000011287
Sequence length 776
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429795:2785150:2882045:1 gene:ENSMLUG00000011289 transcript:ENSMLUT00000011287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKESLGSPSREEIPSSELVGERGKVMDFYKTLRGGATVKVSASPPSLAAAPLSDSKQL
RLLVDFPKGSGSNAQQPDLSQAVSLSMGLYMGETETKVMGNDLGFPQPGQISLSSGETDF
RLLEESIANLSKSTSVPENPKSSASATVSVAPEEEFSKTHTDASSEQQNLKSQTGTNGGN
VKLYTADQRAFDILQDLEFPSGSPGKEMNESPWRPDLLIDEHCLLSPLGGEEDPFLLEGN
SNEDCKPLVLPDTKPKIKDNGDLILPSPSSVTLPQVKTEKEDFIELCTPGVIKQERLGPV
YCQESFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPVFNVIPPISVG
SENWNRCPGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPASSSAASGPPPKLC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKC
LQAGMNLEARKTKKKIKGIQQATTGVSQETSENSANKTIVPATLPQLTPTLVSLLEVIEP
EVLFAGYDCSAPESAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWM
FLMAFALGWRSYRQSNANMLCFAPDLVINEQRMSLPFMYDQCKHMLYVSSELQRLQVSYE
EYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKL
LDSMHEVVENLLHYCFQTFLDKSMSIEFPEMLAEIITNQLPKYSSGNIKKLLFHQK
Download sequence
Identical sequences G1PHX2
XP_006086473.1.53796 XP_006086474.1.53796 ENSMLUP00000010283 ENSMLUP00000010283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]