SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010322 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010322
Domain Number 1 Region: 11-103,133-160
Classification Level Classification E-value
Superfamily EF-hand 8.95e-32
Family EF-hand modules in multidomain proteins 0.00084
Further Details:      
 
Domain Number 2 Region: 438-593
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.62e-31
Family Diacylglycerol kinase-like 0.016
Further Details:      
 
Domain Number 3 Region: 135-249
Classification Level Classification E-value
Superfamily EF-hand 3.66e-24
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 4 Region: 229-299
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.98e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 
Domain Number 5 Region: 302-366
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000493
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010322   Gene: ENSMLUG00000011308   Transcript: ENSMLUT00000011328
Sequence length 593
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429782:10086608:10206704:-1 gene:ENSMLUG00000011308 transcript:ENSMLUT00000011328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKNPEKQLNYKSGEFGNLSRYVDSSYSTKKLKDVLEEFHGNGVLAKYNPEGAQKQDILNQ
TIDFEGFKLFMKTFLEAELPDDFTAHLFMSFSNRFPHASPMVKSKPALLSGGLRMNKGAI
TPPRTSPANTCSPEVIHLKDIVCYLSLLERGRPEDKLEFMFRLYDTDGNGFLDSSELENI
ISQMMHVAEYLEWDVTELNPILHEMMEEIDYDHDGTVSLEEWIQGGMTTIPLLVLLGLEN
NVKDDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKT
YVKSKKNTDVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCHITLHNKCASHLKPE
CDCGPLKDHILPPTTICPVVLNLPTSGVSVPEEKQATVKKEKVGSQQPNKVTDKNKMQRA
NSVTVDGQGLQITPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLAGNGPMP
GLNFFRDVSDFRVLACGGDGTVGWILDCIEKANVAKHPPVAILPLGTGNDLARCLRWGGG
YEGENLMKILKDIENSTEIMLDRWMFEVIPNDKDEKGDPVPYSIINNYFSIGV
Download sequence
Identical sequences G1PI07
ENSMLUP00000010322 ENSMLUP00000010322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]