SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010382 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010382
Domain Number 1 Region: 6-139,168-232
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.58e-49
Family BAR domain 0.0084
Further Details:      
 
Domain Number 2 Region: 250-414
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.06e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010382   Gene: ENSMLUG00000011372   Transcript: ENSMLUT00000011394
Sequence length 417
Comment pep:novel scaffold:Myoluc2.0:AAPE02067299:783:7468:-1 gene:ENSMLUG00000011372 transcript:ENSMLUT00000011394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETAEFLGEDLQQVEQRLEPAKRAAHNVHKRLQACLQGQSGSDMDKRVKKLPLMALSTTMA
ESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLERDVLQPLNRLSEEELPAILKHK
KSLQKLVSDWNTLKSRLSQAAKNSGSGQGLGGGPGSYGHTTTANKVETLKEEEEELKRKV
EQCKDEYLADLYHFATKEDSYANYFINLMEIQADYHRKSLSSLDTALAELKENHSQAEPS
PSMMAAPFSRVYGVSLGAHLQELGRDIALPIEACVLMLLSEGVKEEGLFRLAAGASVLKR
LKQTMASDPRNLQEFCSDPHAVAGALKSYLRELPEPLMTFDLYDDWMKAASLKEPRARLE
ALQEVCSRLPQENFSNLRYLMKFLARLAEDQEVNKMTPSNIAIVLGPNLLWPPEKEG
Download sequence
Identical sequences G1PI61
ENSMLUP00000010382 ENSMLUP00000010382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]