SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010385 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010385
Domain Number 1 Region: 47-137
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-24
Family PDZ domain 0.0019
Further Details:      
 
Domain Number 2 Region: 181-264
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000166
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 279-389
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000275
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010385   Gene: ENSMLUG00000011379   Transcript: ENSMLUT00000011397
Sequence length 517
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429880:3408657:3465695:-1 gene:ENSMLUG00000011379 transcript:ENSMLUT00000011397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTI
RRQTVGGFGLSIKGGAEHNIPVVISKISKEQRAELSGLLFIGDAILQINGINVRKCRHEE
VVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPTSPGLRWEKRWCDLRLLPLLHSRFSQYVPGTDLSRQNAFQVIAVDGVC
SGIIQCLSADDCIDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQD
SVYSPIFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDLLDQRRHCFTV
QSESGEDLYFSVELDCDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF
ICFDAATKAVLWRYKFSHLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIH
SFFAAKVACLDPLFLGHQATASAAASSATMSKAKYTT
Download sequence
Identical sequences G1PI63
ENSMLUP00000010385 XP_005866591.1.60319 XP_014315178.1.53796 XP_014315179.1.53796 XP_014395456.1.60319 XP_014395457.1.60319 XP_014395458.1.60319 ENSMLUP00000010385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]