SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010410 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010410
Domain Number 1 Region: 7-82
Classification Level Classification E-value
Superfamily RING/U-box 2.02e-19
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 93-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000198
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010410   Gene: ENSMLUG00000011435   Transcript: ENSMLUT00000011428
Sequence length 305
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430288:605777:615439:1 gene:ENSMLUG00000011435 transcript:ENSMLUT00000011428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAATPVTSLEEEVSCPICQGALREPVTIDCGHNFCRGCLTRYCETPGPAEGAPACPLCK
EPFRAGGFRPNWQLASVVANIERLKSGSRPGAGGACPEHGEKLYFFCEEDEAQLCALCRE
AAEHRAHAVRFEEAAGPYREQIQTCLECLRKETEEIQEIQSRENQRIHFLLTQVATRRQR
VISEFARLRQFLEEQHSALLAQLEGLEGDILKQRDEFDMLVTGEMSRFSALITELEEKKE
QSARELLTNIRSTLIRCEARKCRKPEAVSPELGQRIRDLPQQALLLQREMKVFLEKLCCE
LDYKP
Download sequence
Identical sequences G1PI88
ENSMLUP00000010410 ENSMLUP00000010410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]