SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010417 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010417
Domain Number 1 Region: 5-214
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-45
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 202-334
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010417   Gene: ENSMLUG00000011429   Transcript: ENSMLUT00000011435
Sequence length 335
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430191:751116:754076:1 gene:ENSMLUG00000011429 transcript:ENSMLUT00000011435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPGPRARCPVQEQRARWERKRACTARELLETERRYQEQLGLVATYFLGILRAKGTLRP
PERQALFGPWELIYGASQELLPYLEGGHWGQGLEGFCPHLELYTQFAANAERSQTTLQEQ
LKKSKRFRRFVRLQEGRPEFGGLQLQDLLPLPLQRLQQYENLVVALAENTSPNSPDHQQL
TRAARLISETAQRVHTIGQKQKNDQHLRRVQALLSGRQAKGLTSGRWFLRQGWLLVVPPR
GEPRPRMFFLFSDVLVLAKPRPPLHLLQSGTFLCRAVYPMAQCQLQRVFGHSGGPCGGLL
SLSFPHEKLLLMSTDREELLRWYHSLTVAISSQKN
Download sequence
Identical sequences G1PI95
ENSMLUP00000010417 ENSMLUP00000010417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]