SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010420 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010420
Domain Number 1 Region: 9-222
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.33e-37
Family PhyH-like 0.074
Further Details:      
 
Domain Number 2 Region: 798-855
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.81e-22
Family Tudor domain 0.0000527
Further Details:      
 
Domain Number 3 Region: 856-911
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.21e-16
Family Tudor domain 0.0000541
Further Details:      
 
Domain Number 4 Region: 632-668
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000219
Family PHD domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010420
Domain Number - Region: 718-773
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00471
Family PHD domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010420   Gene: ENSMLUG00000011414   Transcript: ENSMLUT00000011438
Sequence length 964
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429804:234773:271830:-1 gene:ENSMLUG00000011414 transcript:ENSMLUT00000011438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLKTILDLVEKE
SGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLA
KGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGF
NCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDSTVIDH
TLPTPEAAEFLKESELPPRAASEEECPEEDMEGVEDGEEGHLKRSLAKHRIGTKRHRVCL
EIPQEVSQSELFPKEELSSGQYDLTACQAALAPVRPTHSSVRQVEDGLPFPDYSDSTEVK
FEELKNVKLEEEEEEEEEEEEAAAALDLSVNPASIGGRLVFSGSKKKSSSSLGSSSSQDS
VSSDSETSEPLSCQGQGQTGVLTVHSYARGDGRVAAGEPCTRKKRSASRSISERELAEVA
NEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQDCGSDDETSEQLTPEEEAEETEAWAKPL
SQLWQNRPPNFEAEKEFNETMAQQAPHCSVCMIFQTYHQVEFGGLSQNCADAPDLAPQKQ
RTKPLIPEMCFTTTGCSTDINLSTPYLEEDGTSILVSCKKCSVRVHASCYGVPPAKASED
WMCSRCSANALEEDCCLCSLRGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSK
IPLPRFKLKCVFCKKRRKRTAGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFIT
CFRHRIPNLERAKGALQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDN
LYPEDIVSQDCLQLGPPAEGDVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKR
DDVYTLDEELPKRVKSRLSVASDMRFNEIFTEKEVKQEKKRQRVINSRYREDYIEPALYR
AIME
Download sequence
Identical sequences G1PI98
ENSMLUP00000010420 ENSMLUP00000010420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]