SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010430 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010430
Domain Number 1 Region: 15-146
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-27
Family Phosphotyrosine-binding domain (PTB) 0.008
Further Details:      
 
Domain Number 2 Region: 273-390
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000137
Family SH2 domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010430   Gene: ENSMLUG00000011446   Transcript: ENSMLUT00000011449
Sequence length 428
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429895:1301151:1307476:-1 gene:ENSMLUG00000011446 transcript:ENSMLUT00000011449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKAGARGRRASDCGPAPHRPRCITKFAQYVGSFSVDDLDTQEGVWLVQQQLWALKDCPR
RRAVILKFSLQGLKIYSGEGEVLLMAHALRRILYSTWCPDDCQFAFVARNPRSPASKLFC
HLFVGRQPGEVQILHLLLCRSFQLAYLSQHPAERAQPEPCLGPAGDVPLKPLASPGRPPG
LVREPFVRDQLSQNVRALVSFRRLSAEGPVGSGKELLGLEGCGSARHSRLGNPYCSPTLV
RKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPGAWEAWPQGPGGLASLVESEGSLTENI
WAFAGISRPSALALLRRDVLGAFLLWPEPGACGQWCLSVRTQCGVVPHQVFRNHLGRYSV
EHLPAEFSSLEALVEHHAGTARSLFCSLDMGRLNPGYEEQDCGPESRPPRTLRPLSHAKS
EAELQGLG
Download sequence
Identical sequences G1PIA8
XP_006094070.1.53796 ENSMLUP00000010430 ENSMLUP00000010430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]