SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010465 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010465
Domain Number 1 Region: 402-448
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000327
Family SOCS box-like 0.0068
Further Details:      
 
Domain Number 2 Region: 120-210,269-301
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000119
Family Ankyrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010465   Gene: ENSMLUG00000011493   Transcript: ENSMLUT00000011488
Sequence length 453
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:29836612:29876812:-1 gene:ENSMLUG00000011493 transcript:ENSMLUT00000011488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSDCLPDHPLSSDLVRRLKSALDARDEETVRTVICTQVRHVDAVIELANDDWMKDPSA
QLPPGVLLGFLSLLKDFFIQFRQNIMLIIYIPKIFFMKLYSNPLDYLASCLWTLEYTREL
TTPLCIAAARGHAACVHPAGRGADPNASPEAWPLHEAAWGPTLGQLLLRPRRPDLVGLEA
AEGAHLWGRPLSPKCAQALLEHGASVHRAGGAGPGHAAARGGAGPQCARGSEGSAAARTA
SDPTCRRGSAALRARARPSPCTRLCLGAGRRRTRPTRTSSSPLHKACGHARPGLALLLLR
ARGRRGRARLRKAPRPWARVLQAAACAPQAAPQRTVQALLNHGSPTLWPDAFPKVLQTCA
PAPAVIEVLFNAYPQLRVSESWREVIPEEVFQAHRPFYQSLFALAGSPRRLLHLCRCAIR
RRFGKQCSRLVPLLPLPATLQSYLLLEPEGVLH
Download sequence
Identical sequences G1PIE0
ENSMLUP00000010465 ENSMLUP00000010465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]