SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010474 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010474
Domain Number 1 Region: 290-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-48
Family SPRY domain 0.0000394
Further Details:      
 
Domain Number 2 Region: 8-85
Classification Level Classification E-value
Superfamily RING/U-box 1.1e-17
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 85-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000153
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010474   Gene: ENSMLUG00000011494   Transcript: ENSMLUT00000011497
Sequence length 477
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429905:2765077:2778579:-1 gene:ENSMLUG00000011494 transcript:ENSMLUT00000011497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSSQGSINEQVICRICQQLLTEPMSLHCGHNFCQLCIAANESESFFGGQCRCPVCQST
YDPWHLMPNKELDNIVKKIRELNMWSYQQQQHDLCEQHGENRHLFCKEDGKAICSHCVQE
HPGHQILLVEEVVKECQEKLQVAVDRLMKEEQEAERLEAVINEERDTWKNRMQTERERIL
EGFKEMRAVLNKEEKRELQKLDDNEVHVLDNLAVAKDQVVQQGQYTRELISDLQRHMCES
SMDRLQGLGGLYARSEIWTLKKPKIVSKKLSKFRFPDLSGMLQVFKELAEVQNYWVDLTL
NPFNDVSNVVVSEDQRQVTVGNIMFRNVYPCNFSAFDVWGSQNFSSGKCYWEVDVSGKIA
WILGVYSKTSNLNRKESSGFRPENGYWVVGLQNECEYNAFEDSSTSDPKVLTLSVFVPPH
RVGVFLDYEASTVSFFNVTNHGSLIYKFSKCHFSHTVYPYFNPGNCPVPMKLCPPSS
Download sequence
Identical sequences G1PIE7
ENSMLUP00000010474 ENSMLUP00000010474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]