SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010476 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010476
Domain Number 1 Region: 1235-1342
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-33
Family PDZ domain 0.00000459
Further Details:      
 
Domain Number 2 Region: 1640-1817
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.21e-28
Family Nucleotide and nucleoside kinases 0.00015
Further Details:      
 
Domain Number 3 Region: 1393-1487
Classification Level Classification E-value
Superfamily PDZ domain-like 1.14e-16
Family PDZ domain 0.0088
Further Details:      
 
Domain Number 4 Region: 497-609
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-16
Family PDZ domain 0.0023
Further Details:      
 
Domain Number 5 Region: 621-693
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-16
Family PDZ domain 0.025
Further Details:      
 
Domain Number 6 Region: 1497-1575
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000341
Family SH3-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010476   Gene: ENSMLUG00000011460   Transcript: ENSMLUT00000011499
Sequence length 1820
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429836:243218:306149:1 gene:ENSMLUG00000011460 transcript:ENSMLUT00000011499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSTYSVLSIMPSDSESSSSLSSVGTTGKAPSPPPLLTDRQVNEKVENLSIQLRLMTRERN
ELRKRLAFATHGTTFDKRPYHRLNPDYERLKIQCVRAMSDLQSLQNQHTNALKRCEEVAK
ETDFYHTLHSRLLSDQTQLKDDVDTLRRENGQLLRERNLLQQSWEDMKRLHEEDQKEIGD
LRAQQQQVLKHNGSSEILSKLYDTAIDKLEVVKKDYDALRKRYNEKIAIHSSDLSRLEQL
EEENQRLLKQTDMLTQQRDTAIQLQHQCALSLRRFEAIHHELNKATAQNKDLQWEMELLQ
SELTELRTTQAKTAKESEKYKEERDAVYSEYKLIMSERDQVISELDKLQTEVELAESKLK
SSTSEKKAASEEMEALRQIKDTVTVDAGRANKEAETLRKQCKALCQELKEALQEADVAKC
RRDWAFQERDKIVAERDSIRTLCDNLRRERDRAVTELAEALRSLDDTRKQKNDISRELKE
LKDQMESQLEKEARFRQLMAHSSHDSAIDTDSMEWETEVVEFERETEDIDLKALGFDMAE
GVNEPCLPGDCGIFVTKVDKGSIADGRLRVNDWLLRINDVDLINKDKKQALKALLNGEGA
INMVVRRRKSLGGKVVTPLHINLSGQKDSGISLENGVYAAAVVPGSPAAKEGSLAVGDRI
VAINGIALDNKSLNECESLLRSCQDSLTLSLLKVFPQSSSWSGQNIFENIKDSDKMLSFR
AHGPEVQAQNKRNLMQHNNSTQTDIFCTDRPEDRKEPGPPGGGSSFLHKPFPGGPFPAAP
HTCPSASERSLSSFRSDASGERGYGLGDMCAQRPLLPFETEAGSCGATEAPLDKAEPEGP
HSGGTWPKAGLSSAAAPEKLSVYKKPKQRKSIFDPNTFKRPQTPPKIDYLLPGPGPAHSP
QPSKRVGPLTPPKPPRRSDSIKFQHRLETSSESEATLVGSSPSTSPPGALPRDVDPGEPM
HASPPRKGRVRIASSYYPEADGDSSYLPAKKSCDEDLTSQKVDEQGQKRRRPKSAPSFRP
KLAPVVIPAQFLEEQKWVSASGEVSPELPEWSPYSPGHSSRHSNPPLYPGKASVGTVPRS
MTPSTTVSSILRNPIYTVRSHRVGPCSSPPVPREVGPQVLHPSVQHQGRLSLDLSHRACS
DYSEMRASHGSNSLPSSARLGSSSNLQFKAERIKIPSTPRYPRSVVGSERGSLSHSECST
PPQSPLNIDTLSSCSQSQTSASTLPRIAVNPVVLGERRKDRPYMEEPRHVKLQKGSEPLG
ISIVSGEKGGVYVSKVTGGSIAHQAGLKYGDQLLEFNGINLRSATEQQARLIIGQQCDTI
TILAQYNPHMHQLSSHSRSSSHLDPASTHSTLQGSSATVPEYPSGIDPLMEQDEGPGTPP
TKQSAPSSRMVGDANKKPPEPRVVFVRKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPD
GLVPGDLILEYGSLDVRSKTVEEVYVEMLKPKDGVRLKVQYRPEDFSKVKGLPGDSFYIR
ALYDRLAEVEHELSFKKDDILYVDDTLPQGTFGSWMAWQLDENAQKIQRGQIPSKYVMDQ
EFSRRLSMSEVKDDSNASKTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSNDSIPL
FEDSVSLAYQRVQKVDCTSLRPVLILGPLLDVVKEMLVNKEPSKFCRCPLEVMKASQQAI
ERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKNWHCLLDVAPHAIERLHHMHIYPIVIF
IHYKSAKHIKEQRDPVYLKDKVTQRHSKEQFETAQKIEQEYSRYFTGVVQGGALSSICDQ
IVALVSQEQSKVLWIPACPP
Download sequence
Identical sequences G1PIE9
ENSMLUP00000010476 ENSMLUP00000010476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]