SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010484 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010484
Domain Number 1 Region: 405-513
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-22
Family SH2 domain 0.0006
Further Details:      
 
Domain Number 2 Region: 9-73
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000029
Family SAM (sterile alpha motif) domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010484   Gene: ENSMLUG00000011482   Transcript: ENSMLUT00000011507
Sequence length 534
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430100:769534:806622:1 gene:ENSMLUG00000011482 transcript:ENSMLUT00000011507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRNVPFRSEVLAWDPDSLADYFRKLNYKDCEKAVKKHHIDGPRFLNLTENDIQKFPKL
RVPILSKLSQEINKNEERRSIFAPRKPQVHRFPEEIESHEEENGGWSSFEEDDYESPNDD
QDAEDDGDYESPNEEDQAPVEDDADYEPPPSNDEEALQNSILPAKPFSNSNSMYIDRPLS
GKCPQQPPVPPQRPMAALPPPPAGRSHTPLPTPQPNHEEPSRSRTPKTAKLPAPSIDRST
KPTLDRSLAPFDREPLTLGKKPVFSDKPPTPAGRPLGDHLPKIPKPPLPPTAERHDRSSP
LPGKKPPVPKHARAPDRRENDEDDVHQRPLPQPTLLPMSSNTFPSRSNKPSQKPSHPSSH
MFGAFSESSSSFPQSASLPPCFSQGPCNRPPLRSEGRNFTLPVPTKPQPPSPGEEENSLS
EEWYVSYITRPEAEAALRRINQDGTFLVRDSSRKTPSNPYVLMVLYKDKVYNVQIRYVEE
SHAYMLGTGLRGKEDFQSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHSAGCL
Download sequence
Identical sequences G1PIF7
XP_006101020.1.53796 ENSMLUP00000010484 ENSMLUP00000010484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]