SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010492 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010492
Domain Number 1 Region: 614-936
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-91
Family p120GAP domain-like 0.000000000012
Further Details:      
 
Domain Number 2 Region: 240-347
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-27
Family SH2 domain 0.00069
Further Details:      
 
Domain Number 3 Region: 59-160
Classification Level Classification E-value
Superfamily SH2 domain 6.87e-25
Family SH2 domain 0.0005
Further Details:      
 
Domain Number 4 Region: 368-483
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-24
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 5 Region: 492-627
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.04e-17
Family Synaptotagmin-like (S variant) 0.034
Further Details:      
 
Domain Number 6 Region: 168-241
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000459
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010492   Gene: ENSMLUG00000011486   Transcript: ENSMLUT00000011515
Sequence length 943
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:31092436:31206018:-1 gene:ENSMLUG00000011486 transcript:ENSMLUT00000011515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARPGGEVGLARGTTALAAETFGAGGGFPPLPPPPQLPALGAGLGTVDEGDSLDGPEYEE
EEVAIPLTAPPTNQWYHGKLDRTMAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQTNV
VNHFRNRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRV
RAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREED
PHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTSENIQRFKICPT
PNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIR
RKTKDAFYKNIVKKGYLLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSV
CSVYVVHDSLFDRPNCFQIVVQHFSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPG
TSNKRLRQVSSLVLHIEEAHKLPIKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVF
DDLPPDINRFEITLSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPG
SLRVRARYSMEKIMPEEEYSEFKELILQKDLHVVYALSHVCGQDRTLLASILLRIFLHEK
LESLLLCTLNDREISMEDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMES
KQSCELSPSKLEKNEDVNTNLAHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHK
WPTNTTMRTRVVSGFVFLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLV
EFGAKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVA
HSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR
Download sequence
Identical sequences G1PIG2
ENSMLUP00000010492 ENSMLUP00000010492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]