SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010633 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010633
Domain Number 1 Region: 102-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-55
Family DBL homology domain (DH-domain) 0.0000641
Further Details:      
 
Domain Number 2 Region: 329-446
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-20
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010633   Gene: ENSMLUG00000011661   Transcript: ENSMLUT00000011671
Sequence length 542
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429814:3940443:3951477:-1 gene:ENSMLUG00000011661 transcript:ENSMLUT00000011671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHDEIGGLLPIKRTIRVLDVNNQSFREPEEPSNKRVRPLARVTSLANLISPVRNGAVR
RFGQTIQSFTLRGDNRSPASAQKWSSRSTVPTPAKRRSSVLWSEMLDVSMKESLTTKEIK
RQEAIYEMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTQIFGDLDAYIPLHEDLLA
RLGEATKPSGTIEQIGDILVNWLPGLNAYKGYCSNQLAAKALLDQKKQDPRVQDFLQRCL
ESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHPDVQLLEEAVLIIQGVLSDIN
LKKGESECQYYIDKLEYLDEKQKDPRIEASKVLLCHGELKNKNGHKLYIFLFQDILVLTR
PVTRNDRHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSDKAKNIFRVRFQDPS
PGQSHTLQANDVFHKQQWFNCIRTAIAPFQQATSSPELQGLPELHEEYEENNPAAGNIRA
QRRSSTVSSVTQVEVDGDTSECGSPVHAADNIKSVRAHRTQSGFRKSRDKAHFSGKRKET
LV
Download sequence
Identical sequences G1PIT3
XP_006088488.1.53796 ENSMLUP00000010633 ENSMLUP00000010633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]