SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010635 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010635
Domain Number 1 Region: 1-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.67e-72
Family BAR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 383-498
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.28e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 244-348
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-25
Family Pleckstrin-homology domain (PH domain) 0.0027
Further Details:      
 
Domain Number 4 Region: 595-713
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.07e-25
Family Ankyrin repeat 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010635   Gene: ENSMLUG00000011656   Transcript: ENSMLUT00000011673
Sequence length 763
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429781:925330:1016822:1 gene:ENSMLUG00000011656 transcript:ENSMLUT00000011673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRAALEEVEGDVAELELKLDKLVKLCIVMIDTGKAFCVANKQFMNGIRDLAQYSSNDAVV
ETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKEN
ALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVLQSKRRSEILKSMLSFM
YAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQKHSTIQQKDFSSDDSK
LEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQKKFKDNPTVVVEDLRLC
TVKHCEDIERRFCFEVVSPTKSCMLQADSEKRQAWIKAVQTSIATAYREKGDESEKLDKK
SSPSTGSLDSGNESKDKLLKGESALQRVQCIPGNASCCDCGLADPRWASINLGITLCIEC
SGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYEAKVEKMGIKKPQPGQRQ
EKEAYIKAKYVERKFVDKCSISSSPPDQEKKMISKSCEEKRLSIPKFGPGDQVRASPQSS
ETVKSNDSGIQQSSDDGRESLPSTVSANSLYEPEGERQDSSVFLDSQHLNPGLQLYRASY
EKNLPKMAEALAHGADVNWANSEENKATPLIQAVLGGSLVTCEFLLQNGANVNQRDVQGR
GPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLTIAVEAANADIVTLLRLARMNEEM
RESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
Download sequence
Identical sequences G1PIT5
ENSMLUP00000010635 ENSMLUP00000010635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]