SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010640 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010640
Domain Number 1 Region: 2687-2976
Classification Level Classification E-value
Superfamily BEACH domain 2.09e-126
Family BEACH domain 0.0000000159
Further Details:      
 
Domain Number 2 Region: 3047-3246,3411-3443
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.2e-32
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 3 Region: 2533-2655
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-23
Family PreBEACH PH-like domain 0.015
Further Details:      
 
Domain Number 4 Region: 3451-3519
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1071-1284
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000792
Family Laminin G-like module 0.091
Further Details:      
 
Domain Number 6 Region: 470-514,580-658,865-904
Classification Level Classification E-value
Superfamily ARM repeat 0.00000507
Family HspBP1 domain 0.092
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010640
Domain Number - Region: 1408-1459,1511-1577,1612-1702
Classification Level Classification E-value
Superfamily ARM repeat 0.000125
Family HspBP1 domain 0.045
Further Details:      
 
Domain Number - Region: 2339-2420
Classification Level Classification E-value
Superfamily Cyclin-like 0.000544
Family Retinoblastoma tumor suppressor domains 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010640   Gene: ENSMLUG00000011620   Transcript: ENSMLUT00000011682
Sequence length 3528
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429779:5984862:6164506:-1 gene:ENSMLUG00000011620 transcript:ENSMLUT00000011682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPNTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEINQSEEA
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEAVGGAQNELPLA
ERRGLLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVLM
TISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQTL
LDDFRIWQGYIFLCDLLLRLEQAKETESKDALKDLVNLITSLTTYGVSELKPAGITTGAP
FLLPGFAVPQPAGKGHSVRNVQAFAVLQNAFLKAKTNFLAQIILDAITNIYMADNANYFI
LESQHTLSQFAEKISKLPEVQSKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSYHCSI
IAMKTLLKFTRHDYIFKDVFREVGLLEVMVTLLHKYAALLKDPTQALNEQGDSRNNSSIE
DQKHLALLVMETLTLLLQGSNTNAGIFREFGGARCAHNIVRYPQCRQHALMIIQQLVLSP
NGDDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRSRTVFRKVGGFVYITSLLVA
MERSLSSPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVR
FLGCFSDLRKISPMNVFPSNTQPFQRLLEEDITSMDSVSPTLQHCSKLFIYLYKVATDSF
DSRAEQIPPCLTSESSLPSPWGTPALSRKRHAYHSVSTPPVYPPKNDLKLHVATSSLQSS
DAVIIHPGAMLAMLDLLASVGSVAQPEHALDLQLAVANILQALVHTERNQQVMCEAGLHA
RLLQRCSAALADEDHALHPPLQRMFERLASQALEPMVLREFLRLASPLNCGAWDKNLLKQ
YRVHKPSSLSYEPEMRSSLIMSMEGLGSDNVFSLHEDNHYRISKSLVKSAEGSTVPLTRV
KCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGCLFLPSLAPHNAPTNSAVTTGLTDGA
VVSGIGSGERFFPPPSGLSYSSWFCIEHFSSPPNNHPVRFLTVVRRANSSEQHYVCLAIV
LSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCCARFRCGELIVEGQWHHLVLVMSK
GMLKNSTVALYIDGQLVSTVKLHYVHSTPGGSGSVNPPVVSTVYAYIGTPPAQRQIASLV
WRLGPTHFLEEVLPPSSVTTIYELGPDYVGSFQAVCMPCKDAKSEGIVPSPVLLVPEEKV
SFGLYALSVSSLTVARIRKVYNKLDSKAIAKQLGISSHENATPVKLIHNAAGHLNGPART
IGATLIGYLGVRTFVPKPVATTLQYIGGAAAILGLVAMASDVEGLYAAVKALVCVVKSNP
LASKEMERIRGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHETSIIPNSTAFQDLL
CDFEVWLHAPYELHLSLFEHFIELLTESSEASKNAKLMREFQLIPKLLLTLRDMSLSQPT
IAAISNVLSFLLQGFPSSYDLLRFGQFISSTLPTFAVCEKFVVMEINHEEKLDTGTEEEF
GGLVSANLILLRNRLLDILLKLVYTSKEKTSINLQACEELVRTLGFDWIMMFMEEHLHPT
TVTAAMRILVVLLSNQSILIKFKEGLSGGGWLEQTDSVLTNKIGTVLGFNVGRSAGGRST
VREINRDACHFPGFPVLQSFLPKHTNVPALYFLLMALFLQQPVSELPENLQVSVPVTSSR
CKQGCQFDLDSIWTFIFGVPASSGTVVSSIHNVCTEAAFLLLGMLRSMLNSPWQSEEEGS
WLREYPVTLMQFFRYLYHNVPDLASMWMSPDFLCALAATVFPFNIRPYSEMVTDLDDEVG
SPAEEFKAFAADTGMNRSQSEYCNVGVKTYLTNHPAKKFVFDFMRVLIIDNLCLTPASKQ
TPLVDLLLEASPERSTRTQQKEFQTYILDSVMDHLLAADVLLGEDASLPITSGGSYQVLV
NNVFYFTQRVVDKLWQGMFNKESKLLIDFIIQLIAQSKRRSQGLSLDAVYHCLNRTILYQ
FSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCLAHCLINLHVGSNVDGFGL
EAEARMTTWHIMIPSDIEPDGGYSQDISEGRQLLIKAVNRVWTELIHSKKQALEELFKVT
LPVNERGHVDIAVARPLIEEAGLKCWQNHLAHEKKCISRGEALVPTCQSKLSRVSSGFGL
SKLTGSRRNRKESGLNKHSLSTQEISQWMFTHIAVVRDLVDTQYKEHQERQQNALKYVTE
EWSQIEYELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYNHYPYVPDTEQ
ETSVASEIPSKQPETSDDIIPQKKPARYRRAISYDSKEYYMRLASGNPAIVQDAIVESSE
GEAAQQEPEHGEDTIAKVKGLVKPPLKRSRSAPDGGDDENQEQLQDQIAEGGSIEEEEKT
DNATLLRLLEDGEKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRDIET
LPPNMHEPIIPRGARQGPSQLKRTCSIFAYEDIREVHKRRYLLQPIAVEVFSGDGRNYLL
AFQKGIRNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERG
EISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEEVDLSNPKTFRNLAKPMGAQTD
ERLAQYKKRYKDWEDPNAGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDL
ADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVILP
PWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQV
DIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPKRVRSRLNGDNAGISVPPGYTGDKI
FFHHLDNLRPSLTPVKELKEPVGQIVCTDKGILAVEQNKVLIPPTWNKTFAWGYADLSCR
LGTYESDKAVTVYECLSEWGQILCAICPNPRLVITGGTSTVVCVWDMGTSKEKAKTLTLK
QALLGHTDTVTCATASFAYHIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPVSALCINEL
TGDIVSCAGTYIHVWSINGNPVVSVNTFTGRSQQIVCCCVSEMNEWDTQNVIVTGHSDGV
VRFWRMEFLQVPETPAPEPTEALEMQEDCPEAQIGQEAQDEDSSDSEADEQSISQDPKDA
PSQPPSTSHRPRAASCRATAAWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRAHL
QGPLNHPHPHPTLMEVRNYSRLKPGYRWERQLVFRSKLTMHTAFDRKDNAHPAEITALGI
SKDHSRILVGDSRGRVFSWSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRN
CGQLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNLQHERGSEDGPRNC
Download sequence
Identical sequences G1PIU0
ENSMLUP00000010640 ENSMLUP00000010640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]