SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010675 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010675
Domain Number 1 Region: 363-624
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.11e-56
Family Nuclear receptor ligand-binding domain 0.0000000188
Further Details:      
 
Domain Number 2 Region: 291-368
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010675   Gene: ENSMLUG00000011728   Transcript: ENSMLUT00000011719
Sequence length 626
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429947:449473:475989:-1 gene:ENSMLUG00000011728 transcript:ENSMLUT00000011719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYSPPPPGSSYAAQTYSSEYTAEIMNPDCAKLTMDLGSTEITARATTSLPSFST
FVEGYSNYEFKPSCQYQMQPPGPRPLIKVEEGHPHSYHHHHHPHHHHHHHQQQPQPEPSI
PPSSGPEDEVLPSTSMYFKQSPPSTPTTPGFPPQAGALWDDALPSAQGCIAPGPLLDPPM
KALSGARFPLFHFKPSPPHPPAPSPAGGHHLSYDPTAAAALSLSLGAAAAAGSQAPALEG
HPYGLPLPKRAAALAFPPLNLTASPTASSLLGESPSLPSPPIRSSSSGEGTCAVCGDNAA
CQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKE
VVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPSCMMNALVRALTDSTPRELDYSRYC
PSDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVL
RLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLSLQSLNLDIQALACLSAL
SMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTEPKVLGALVELRKICTLGLQR
IFYLKLEDLVSPPSIIDKLFLDTLPF
Download sequence
Identical sequences G1PIX0
ENSMLUP00000010675 XP_006096532.1.53796 XP_006096533.1.53796 ENSMLUP00000010675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]