SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010676 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010676
Domain Number 1 Region: 5-132
Classification Level Classification E-value
Superfamily PX domain 1.57e-25
Family PX domain 0.00093
Further Details:      
 
Domain Number 2 Region: 233-287
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000407
Family SH3-domain 0.0022
Further Details:      
 
Domain Number 3 Region: 162-218
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000249
Family SH3-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010676   Gene: ENSMLUG00000011725   Transcript: ENSMLUT00000011720
Sequence length 361
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430099:507358:509425:-1 gene:ENSMLUG00000011725 transcript:ENSMLUT00000011720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGPRHPVSVRAAALVQIEKLQMFAFSVCWSDDSNTLVRRSWDEFKRLHKILKETFPVEA
GLLRRSDRVLPKLPDASTSLLARGGRKGRGLARLQLLEAYSQALLEAEQVSRGPLLTAFF
EPQLQDLEPSLPLGSLVILPVLEEPPPRPVGSLAIGSLEALRLHCLQPFSTQDTRGQPFH
AQAQEALDVLLRHPSGWWLVANEDQQTAWFPAPYLEEVALGQGQDGRQPLRSSGSQFCAS
QAYEGSRADELSVPAGARVRVLEMSDRGWWLCRFGGRTGLLPSVLLQADGLGTLLNGPGL
PSGAEGGENRAGEAQSSPKSPQVMTLPPTVPARPLLSAIQNRCCTITRRALGRDPRSQGH
P
Download sequence
Identical sequences G1PIX1
ENSMLUP00000010676 XP_006100958.1.53796 ENSMLUP00000010676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]