SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010693 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010693
Domain Number 1 Region: 52-95
Classification Level Classification E-value
Superfamily RING/U-box 0.00000786
Family RING finger domain, C3HC4 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010693
Domain Number - Region: 126-175
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00105
Family B-box zinc-binding domain 0.0052
Further Details:      
 
Domain Number - Region: 199-248
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00504
Family B-box zinc-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010693   Gene: ENSMLUG00000011733   Transcript: ENSMLUT00000011739
Sequence length 875
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429808:4982222:5026636:1 gene:ENSMLUG00000011733 transcript:ENSMLUT00000011739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPEPAPARSSGTQQDSALPDMSTMPPPESPSESQQPSPDHSPTEQTTEEEFQFLRCHGC
QAEAKCPKLLLCLHTLCSGCLQAPDMQCPICQASLPPGADGPVLDNIFFESLQRRLSVYQ
QIVDAQAVCTRCKEPADFWCFECEQLLCASCFEAHQWFLKHEARPLAELRGQAVCQFLDA
TRKSNNIFCANSNHRNPTLTSIYCRGCSKPLCCTCALLDSGHSDLKCDITAEIQQRQEEL
DTMTQALQEQDSAFGMAQAQMRSAVSQLGRVRTNLEELIRARVSQLVAHVLAQEKELLEA
VNARYQSEYKKIAGQLGQLDAVLQRIRTGSVLVQRMKRYASDQEVLDMHGFLREALRRLR
QEEPQRLHAAVRTDGFEEFKERLQDLVSCITKGTDAALPRRANPEETSTPREPSDVDLPE
GAQIAQVQALGLAEAQPVAVVQSVPGTHPVPMYAYSIKDPSCREEVSNTATPQKRRKSCQ
TECRRKVIKMESEEEKEARLSLSSPEQPRPSTSKAVSPLPVEGSQSPESHTAGNEELNNH
ETGDSGEAEERVVVISSSEDSDAENSSFRELDDSSSESSDLQLEGTDSLRVLDESLTDLQ
SEVRPLVFFDLKIDNETQKIRQLAAVNQESKFRVLIQPEALSIHSKAVSLEVGLQHFLCF
LSSMCRPILACYKLWGPSLPNFFRALEDMNKLCEFQEAISGFLATLPLIQERVPQASSFK
LKSLAKTYLARNMSEHSALAAVLTMRDLCRLLEVSPGPQLAQHFYSFSSLQCFGSLQPLV
QAAVLPRAEARLLALHNVSFTELLTAHCQDPQGGLKKYSRYLQATSSPPARPALNFQAMS
TYFKSLLEGPALAVGEGICTPLASHSLAQRAPQHS
Download sequence
Identical sequences G1PIY7
ENSMLUP00000010693 ENSMLUP00000010693 XP_006087912.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]