SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010734 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010734
Domain Number 1 Region: 235-576
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.27e-131
Family Mammalian PLC 0.00000000112
Further Details:      
 
Domain Number 2 Region: 66-233
Classification Level Classification E-value
Superfamily EF-hand 9.85e-53
Family EF-hand modules in multidomain proteins 0.00000729
Further Details:      
 
Domain Number 3 Region: 815-878,919-954
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 2.48e-25
Family C-terminal domain of PLC-beta 0.0027
Further Details:      
 
Domain Number 4 Region: 596-714
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.64e-24
Family PLC-like (P variant) 0.0000707
Further Details:      
 
Domain Number 5 Region: 2-64
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000135
Family Pleckstrin-homology domain (PH domain) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010734   Gene: ENSMLUG00000011763   Transcript: ENSMLUT00000011782
Sequence length 954
Comment pep:novel scaffold:Myoluc2.0:GL430679:21150:138398:1 gene:ENSMLUG00000011763 transcript:ENSMLUT00000011782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISYLNLVAFQEEVAKEWTNEVFNLATNL
LAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDS
IPQEDFTPEVYRVFLNHLCPRPEIDNIFSEFGAKSRPYLTVDQMMDFINIKQRDPRLNEI
LYPPLKQEQVQVLIEKYEPNTSLATKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQP
LSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFT
MTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPL
EKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSSKKKLSEQVSNTCSDSSSVFEPSS
PGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKR
NRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQM
VALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVK
IISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPS
LACLRIAAYEEGGKFIGHRILPVQAIRPGYHYICLRNERNQPLMLPAVFVYIEVKDYVPD
TYADVIEALSNPIRYVNLMEQRSKQLAALTLEDEEAIKKEPDPGETSSEALSEAGTTPAE
NGVNHTTSLAPKPPSQAIHSQPAPGPGKAPAKTEDLIHSVLTEVEAQTIEELKQQKSFVK
LQKKHYKEMKELVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAALEKTARKDSKKKSEPS
SPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSGKYRNREHL
Download sequence
Identical sequences G1PJ21
ENSMLUP00000010734 ENSMLUP00000010734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]