SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010760 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010760
Domain Number 1 Region: 276-462
Classification Level Classification E-value
Superfamily NTF2-like 1.9e-60
Family NTF2-like 0.00000148
Further Details:      
 
Domain Number 2 Region: 14-104
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.67e-35
Family Non-canonical RBD domain 0.000073
Further Details:      
 
Domain Number 3 Region: 109-264
Classification Level Classification E-value
Superfamily L domain-like 6.12e-32
Family mRNA export factor tap 0.0000046
Further Details:      
 
Domain Number 4 Region: 459-525
Classification Level Classification E-value
Superfamily UBA-like 3.83e-22
Family TAP-C domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010760   Gene: ENSMLUG00000011810   Transcript: ENSMLUT00000011811
Sequence length 529
Comment pep:novel scaffold:Myoluc2.0:GL429780:110701:123664:-1 gene:ENSMLUG00000011810 transcript:ENSMLUT00000011811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKAYQNRTPERLMENTQDGNLGDWFKITVPYGIKYDKTWLMNSIQSHCSVPFTPVDFHYV
KHLAQFFVQDASAASALKDINYKIFDEENQKIPIFVNTSAVPYSMCNKLEPEKMEQLKLT
ISKRYDVSQKALDLHKLRFDPDLLGHDIIIILNRRNCMTAILQTIKKNIPELLSLNLCKN
KLCQLDGLSDIIQIAPTIKTLNLSKNELKSARELDKIKGLKLEELWLQGNPLCNTFPNQP
TYVSAIRKYFPNLSRLDGQDLPPPTVTGIVDMDIIKPCKESFKGPETLKNLIFQFLLHYY
LIYDSEDRESLLSAYHEEACFSLTVPYNSEDPALSNLCEYLKDNRNMKNLKDSDLRFQLL
KHTKCEIVNSLCVFPKTQHDLNSYVVDLWAHTEIMLCFSVSGVFKEVIEVERKSQGSVRA
FTRTFILSSGSNSSMCIVNDILTVGNARTEETQSAFSIPVPTPTFSSLSTLSQEQQEMVQ
IFSIQSGISLQWSQKCLQDNEWNYIKAAQVFATFKTQGKIPEEAFKQIS
Download sequence
Identical sequences G1PJ46
ENSMLUP00000010760 ENSMLUP00000010760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]