SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010776 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010776
Domain Number 1 Region: 30-76
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000000366
Family Elafin-like 0.0014
Further Details:      
 
Domain Number 2 Region: 85-132
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000366
Family Elafin-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010776   Gene: ENSMLUG00000011837   Transcript: ENSMLUT00000011828
Sequence length 134
Comment pep:novel scaffold:Myoluc2.0:AAPE02061998:755:9156:-1 gene:ENSMLUG00000011837 transcript:ENSMLUT00000011828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLNNLLVFTVLLALRILSSWAVVDAGKEKAKPGACPFIYPANYLVYEPPQCHSDWQCPK
KQKCCPGLCGTKCLDPEDPSKPVKVPPKPGSCPRIQMKCAMMNPPNKCMMDSQCAGNKKC
CMGYCGRVCMMPKN
Download sequence
Identical sequences G1PJ61
ENSMLUP00000010776 ENSMLUP00000010776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]