SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010795 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010795
Domain Number 1 Region: 341-421
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000124
Family Ubiquitin-related 0.0027
Further Details:      
 
Domain Number 2 Region: 260-337
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000369
Family Ubiquitin-related 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010795   Gene: ENSMLUG00000011851   Transcript: ENSMLUT00000011849
Sequence length 422
Comment pep:novel scaffold:Myoluc2.0:GL430445:112454:120775:-1 gene:ENSMLUG00000011851 transcript:ENSMLUT00000011849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPVRKRGRRSRGGGVGRGTRGARGRRPGAQRSPARRSVESVLVDLVSDSDEEILEVST
ARGSADPVEAPLPESPVPAAPPDSRDDSDSDSDSEGADARPAGAPPTVVRRRRRLLLDPG
EAPAVPVYSEKVKSSLQLLPDHLPLLKLCPPGAEEEVDMADSSSPHAEDLSGPDSPWKRK
LRSKAEEEKEKRTVSLSRDTSPLPSPLPRTKSRKHTRALQKRREVNKRLQDLRSCLSPKQ
RQGQDHLSQDDEVILLEGPILPRSPRRFQLKVRCRADLIRLPVTMSEPLQSVVDHMATHL
GVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLASSPEAAEASHLLQLRVQGKEK
HQTLQVSLSRDSPLKTLMSHYEEAMGLSGHKLSFFFDGTKLSGKELPADLGMESGDLIEV
WG
Download sequence
Identical sequences G1PJ77
ENSMLUP00000010795 ENSMLUP00000010795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]