SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010800 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010800
Domain Number 1 Region: 37-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000122
Family Ubiquitin-related 0.0000712
Further Details:      
 
Domain Number 2 Region: 333-376
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000766
Family UBA domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010800   Gene: ENSMLUG00000011861   Transcript: ENSMLUT00000011855
Sequence length 380
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429808:5409456:5425262:-1 gene:ENSMLUG00000011861 transcript:ENSMLUT00000011855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSDWHLAVKLADQPLAPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPEL
IDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAALREFRVLHTAL
HSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVP
AHPALVNAIVLVLHSVAGSTPLPGADSSSRSTPSSSYRDMPGGFLFEGLSDDEDDFHPRA
RSMPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGT
SPLSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELSLRAL
QATGGDIQAALELIFAGGAP
Download sequence
Identical sequences G1PJ82 L5MGK7
ENSMLUP00000010800 XP_006087929.1.53796 XP_006753790.2.95426 XP_006753792.1.95426 XP_014310502.1.53796 XP_015420112.1.95426 ENSMLUP00000010800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]