SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010820 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010820
Domain Number 1 Region: 300-468
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-56
Family SPRY domain 0.0000556
Further Details:      
 
Domain Number 2 Region: 82-134
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000794
Family B-box zinc-binding domain 0.0012
Further Details:      
 
Domain Number 3 Region: 2-66
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000932
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010820   Gene: ENSMLUG00000011874   Transcript: ENSMLUT00000011876
Sequence length 471
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430490:27609:37844:-1 gene:ENSMLUG00000011874 transcript:ENSMLUT00000011876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XELFREPVSVECGSICRACIARCWERPGASAAAPRLPCPLPCPQCREPARPSQLRPNRQL
AAVAALLRRFSLPGAAAERGPPEAAGCAQHGEPLKLYCQDNGRAICVVCDCAREHRAHAV
IPLDEAVQEAKGSLFDPXLKALKSDLEDYEVFRSTEEKESKELLRQKQMAAEREKVGAEF
QALRAFLVEQEGRLLGRLEELSREVTQKQNENLAQLGGEIAQLSKLTSQIQETTSKPDLD
FLQEFKNTLSRCSNVPAPKPSTVSSEMKNKVWNVSLKTFVLKGLLKKFKEDLRGELEKEE
KVELTLDPDSANPRLILSLDLKSVRLGQRAQDLPNHPRRFDTNTRVLASCGFSSGRHHWE
VEVGSQDGWAFGVARESVRRKGLTPFTPEEGVWALQLNGGQYWAVTSPERTPLSCGHLSR
VRVALDLEVGAVSFYAVEDMRHLYTFRVNFQERVFPLFSICSTGTYLRIWP
Download sequence
Identical sequences G1PJA0
ENSMLUP00000010820 ENSMLUP00000010820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]